Transcript | Ll_transcript_452764 |
---|---|
CDS coordinates | 168-608 (+) |
Peptide sequence | MAPSSIVEEVDIGDGGNVGITIGEALEATALTAGKKPVEWSDAAAIQAAEVRATGRTNIVPGGVAAAAQSAATLNARLTKNEEKTKLRDILADATSKLPSDRAATRRDAEGVVSAELRNDPYLTTHPAGVAASVAAAARLNQNNHN* |
ORF Type | complete |
Blastp | Late embryogenesis abundant protein 47 from Arabidopsis with 78.23% of identity |
---|---|
Blastx | Late embryogenesis abundant protein 47 from Arabidopsis with 78.23% of identity |
Eggnog | Seed maturation family protein(ENOG41118DT) |
Kegg | Link to kegg annotations (AT5G27980) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019452233.1) |
Pfam | Seed maturation protein (PF04927.11) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer