Protein coding transcript 1559

• Transcript: Ll_transcript_452764
• CDS coordinates: 168-608 (+)
• Peptide sequence: MAPSSIVEEVDIGDGGNVGITIGEALEATALTAGKKPVEWSDAAAIQAAEVRATGRTNIVPGGVAAAAQSAATLNARLTKNEEKTKLRDILADATSKLPSDRAATRRDAEGVVSAELRNDPYLTTHPAGVAASVAAAARLNQNNHN*
• ORF Type: complete

Annotations of Ll_transcript_452764

• Blastp: Late embryogenesis abundant protein 47 from Arabidopsis with 78.23% of identity
• Blastx: Late embryogenesis abundant protein 47 from Arabidopsis with 78.23% of identity
• Eggnog: Seed maturation family protein(ENOG41118DT)
• Kegg: Link to kegg annotations (AT5G27980)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019452233.1)
• Pfam: Seed maturation protein (PF04927.11)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;