Protein coding transcript 156071

• Transcript: Ll_transcript_228707
• CDS coordinates: 282-857 (+)
• Peptide sequence: MFQIAQKPSIYVLDTPGVLVPSIANIETGLKLALAGSVKDSVVGEERIAQYLLAVLNIRGTPLHWRHLKNRRIDGIEYDAEEKHEYNLKNLKPKRKNMPNRSDLVYVQDLVMDVQHALYSTVTEYGRNVEDENDLEDLIDKQFDALQKAFKIPHKASEARLMVSKKFLTLFRTGKLGPFILDDVPDVKPVS*
• ORF Type: complete

Annotations of Ll_transcript_228707

• Blastp: Short integuments 2, mitochondrial from Arabidopsis with 67.38% of identity
• Blastx: Short integuments 2, mitochondrial from Arabidopsis with 67.38% of identity
• Eggnog: Required for a late step of 50S ribosomal subunit assembly. Has GTPase activity (By similarity)(COG1161)
• Kegg: Link to kegg annotations (AT2G41670)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019444057.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;