Protein coding transcript 156125

• Transcript: Ll_transcript_229455
• CDS coordinates: 129-494 (-)
• Peptide sequence: GHLPDTISCLQDIEVLNLAHNKLSGELSDVICSLRSLVNLTVAYNFFSGFSQQCSRLFNVGFDFSDNCIPGRDMQRPQPECSVIPGGSLSCLRIPTPKPIACISLAASLNSMHTDHSSPSP*
• ORF Type: 5prime_partial

Annotations of Ll_transcript_229455

• Blastp: Leucine-rich repeat extensin-like protein 6 from Arabidopsis with 45.05% of identity
• Blastx: Leucine-rich repeat extensin-like protein 6 from Arabidopsis with 45.05% of identity
• Eggnog: leucine-rich repeat extensin-like protein(ENOG410Y973)
• Kegg: Link to kegg annotations (AT3G22800)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019446401.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;