| Transcript | Ll_transcript_235365 |
|---|---|
| CDS coordinates | 30-302 (+) |
| Peptide sequence | MFLKSKLKKNPGRAERSFARYDCLTVMKKFVLTSWPHFIVAPHGMEIVDFLPTPSVIPSWITEQELMFFADKFQESGFTGAFNYYRAMDL* |
| ORF Type | complete |
| Blastp | Epoxide hydrolase A from Mycobacterium tuberculosis complex with 39.22% of identity |
|---|---|
| Blastx | Epoxide hydrolase A from Mycobacterium tuberculosis complex with 39.22% of identity |
| Eggnog | Hydrolase(ENOG410XVV6) |
| Kegg | Link to kegg annotations (Rv3617) |
| CantataDB | - |
| Mirbase | - |
| Ncbi protein | Link to NCBI protein (XP_019446868.1) |
| Pfam | - |
| Rfam | - |
| GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer