Protein coding transcript 156160

• Transcript: Ll_transcript_235366
• CDS coordinates: 342-782 (+)
• Peptide sequence: MKKFVLTSWPHFIVAPHGMEIVDFLPTPSVIPSWITEQELMFFADKFQESGFTGAFNYYRAMDLNWELLAPWEGSKITVPTKLIVGDKDFGFESGGVRDYVEGELFKSLVPNVEVVIIDGHHFIHQERAQQVSHQILSFIHKLSLD*
• ORF Type: complete

Annotations of Ll_transcript_235366

• Blastp: Epoxide hydrolase A from Mycobacterium tuberculosis complex with 33.33% of identity
• Blastx: Epoxide hydrolase A from Mycobacterium tuberculosis complex with 32.05% of identity
• Eggnog: Hydrolase(ENOG410XVV6)
• Kegg: Link to kegg annotations (Rv3617)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019446868.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;