Transcript | Ll_transcript_235382 |
---|---|
CDS coordinates | 3-710 (+) |
Peptide sequence | SLALDLSPADDIFFHGHLLPLHLLSHLPSSPRFSTNSFHSLLEDENHSKDNGCSSSNRNNSITIDNIGNNNSNNNNNSNIAECNIIGTKEESKSKPTFSLFGLVRGHKGCQVRDKESKEKQKKKLGFEVIHALKRYLQIVQPLVLFRGRREKVGLQKQSYSHSGNLIRRNKVELIGRRGGYSAPASMRSSQTNSSVLLATTTLPSDNDSTMEELQSAIQAAIAHCKNSVAREHKC* |
ORF Type | 5prime_partial |
Blastp | BRI1 kinase inhibitor 1 from Arabidopsis with 40.07% of identity |
---|---|
Blastx | Probable BRI1 kinase inhibitor 1 from Oryza sativa with 60.78% of identity |
Eggnog | BRI1 kinase inhibitor(ENOG410YVQJ) |
Kegg | Link to kegg annotations (AT5G42750) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019433115.1) |
Pfam | - |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer