Protein coding transcript 156176

• Transcript: Ll_transcript_235392
• CDS coordinates: 3-710 (+)
• Peptide sequence: SLALDLSPADDIFFHGHLLPLHLLSHLPSSPRFSTNSFHSLLEDENHSKDNGCSSSNRNNSITIDNIGNNNSNNNNNSNIAECNIIGTKEESKSKPTFSLFGLVRGHKGCQVRDKESKEKQKKKLGFEVIHALKRYLQIVQPLVLFRGRREKVGLQKQSYSHSGNLIRRNKVELIGRRGGYSAPASMRSSQTNSSVLLATTTLPSDNDSTMEELQSAIQAAIAHCKNSVAREHKC*
• ORF Type: 5prime_partial

Annotations of Ll_transcript_235392

• Blastp: BRI1 kinase inhibitor 1 from Arabidopsis with 40.07% of identity
• Blastx: Probable BRI1 kinase inhibitor 1 from Oryza sativa with 60.78% of identity
• Eggnog: BRI1 kinase inhibitor(ENOG410YVQJ)
• Kegg: Link to kegg annotations (AT5G42750)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019433115.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;