Protein coding transcript 1562

• Transcript: Ll_transcript_452813
• CDS coordinates: 112-702 (+)
• Peptide sequence: MKEMGDVVSPFIVSSSPKPSPSSNIYTIPFLYYGLVVVGTATIVLAIYNLIIIKCCSNRVQTQPSQPSGHSRSLVELVVNESRSFNNNNSQKGNFFSISSFKYKKEVVLRNEGGKEKQQQQGGVDDYECPVCLSFYEEGDDVKNLPLCKHSFHAICIDMWLYSHFDCPICRTPVAPFFHHPFPAQNSHHGFDSTYV*
• ORF Type: complete

Annotations of Ll_transcript_452813

• Blastp: RING-H2 finger protein ATL1 from Arabidopsis with 29.94% of identity
• Blastx: RING-H2 finger protein ATL52 from Arabidopsis with 32.37% of identity
• Eggnog: zinc ion binding(ENOG41121N2)
• Kegg: Link to kegg annotations (AT1G04360)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019416232.1)
• Pfam: Ring finger domain (PF13639.5)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;