Protein coding transcript 156261

• Transcript: Ll_transcript_235213
• CDS coordinates: 625-1314 (+)
• Peptide sequence: MGEREWYFFVPRDKKHGSGGRPNRTTEKGFWKATGSDRKIVTLSDPKRIIGLRKTLVFYEGRAPRGYKTDWIMNEYRLPDNCKLPKEIVLCKIYRKATSLKVLEQRAALEEETKQLVGSPPSSTDTMSYNNQMEDQTMPLTSFKHVVLKKEAEAEEMVSVQENRSTELSNKEKKRSCGTSIQLPLGSDILPELELPMMTTDWTQDSFWAQFNSPWLQNLTPTYYNILNF*
• ORF Type: complete

Annotations of Ll_transcript_235213

• Blastp: NAC domain-containing protein 35 from Arabidopsis with 58.59% of identity
• Blastx: NAC domain-containing protein 35 from Arabidopsis with 43.22% of identity
• Eggnog: nac domain(ENOG410YIMX)
• Kegg: Link to kegg annotations (AT2G02450)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019465072.1)
• Pfam: No apical meristem (NAM) protein (PF02365.14)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;