Protein coding transcript 156353

• Transcript: Ll_transcript_233884
• CDS coordinates: 88-906 (+)
• Peptide sequence: MKQHELTVLLCLIWALTLLYGEMFAFWVPPFFTCSWPHLTHSSSSSKAENGSYQADYVKVAVIADPQLMDRTSLRLPAKSLALEIAEFYTDLNMRRSFSASILPFKPDVILFLGDYFDGGPYLSDEEWQESFSRFKRIFGLNAQGKYTDIQVYYVPGNHDIGYGSLHSLKPEVIQRYEETFGIRNYNFVVGKVNFITVDAQTLDGPPQKHLISQTWEFVKNISVDGALHPRVLLTHIPLYRPDNTYCGPDRNSPVINQRISRTVNGNTSDIA*
• ORF Type: complete

Annotations of Ll_transcript_233884

• Blastp: Cell division control protein 1 from Saccharomyces with 30.22% of identity
• Blastx: Cell division control protein 1 from Saccharomyces with 31.37% of identity
• Eggnog: -
• Kegg: Link to kegg annotations (YDR182W)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019461990.1)
• Pfam: Calcineurin-like phosphoesterase (PF00149.27)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;