Transcript | Ll_transcript_233884 |
---|---|
CDS coordinates | 88-906 (+) |
Peptide sequence | MKQHELTVLLCLIWALTLLYGEMFAFWVPPFFTCSWPHLTHSSSSSKAENGSYQADYVKVAVIADPQLMDRTSLRLPAKSLALEIAEFYTDLNMRRSFSASILPFKPDVILFLGDYFDGGPYLSDEEWQESFSRFKRIFGLNAQGKYTDIQVYYVPGNHDIGYGSLHSLKPEVIQRYEETFGIRNYNFVVGKVNFITVDAQTLDGPPQKHLISQTWEFVKNISVDGALHPRVLLTHIPLYRPDNTYCGPDRNSPVINQRISRTVNGNTSDIA* |
ORF Type | complete |
Blastp | Cell division control protein 1 from Saccharomyces with 30.22% of identity |
---|---|
Blastx | Cell division control protein 1 from Saccharomyces with 31.37% of identity |
Eggnog | - |
Kegg | Link to kegg annotations (YDR182W) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019461990.1) |
Pfam | Calcineurin-like phosphoesterase (PF00149.27) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer