Protein coding transcript 156354

• Transcript: Ll_transcript_233885
• CDS coordinates: 88-651 (+)
• Peptide sequence: MKQHELTVLLCLIWALTLLYGEMFAFWVPPFFTCSWPHLTHSSSSSKAENGSYQADYVKVAVIADPQLMDRTSLRLPAKSLALEIAEFYTDLNMRRSFSASILPFKPDVILFLGDYFDGGPYLSDEEWQESFSRFKRIFGLNAQGKYTDIQVYYVPGNHDIGYGSLHSLKPEVFQHAQLSKNDKMKM*
• ORF Type: complete

Annotations of Ll_transcript_233885

• Blastp: Metallophosphoesterase 1 from Mus with 26.53% of identity
• Blastx: Metallophosphoesterase 1 from Mus with 26.53% of identity
• Eggnog: Metallophosphoesterase 1(ENOG410ZM57)
• Kegg: Link to kegg annotations (225651)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019461990.1)
• Pfam: Calcineurin-like phosphoesterase (PF00149.27)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;