| Transcript | Ll_transcript_233878 |
|---|---|
| CDS coordinates | 88-471 (+) |
| Peptide sequence | MKQHELTVLLCLIWALTLLYGEMFAFWVPPFFTCSWPHLTHSSSSSKAENGSYQADYVKVAVIADPQLMDRTSLRLPAKSLALEIAEFYTDLNMRRSFSASILPFKPDVILFLGDYFDGGPYLSDEE* |
| ORF Type | complete |
| Blastp | Metallophosphoesterase 1 homolog from Sophophora with 28.33% of identity |
|---|---|
| Blastx | - |
| Eggnog | Metallophosphoesterase 1(ENOG410ZM57) |
| Kegg | Link to kegg annotations (Dmel_CG8455) |
| CantataDB | - |
| Mirbase | - |
| Ncbi protein | Link to NCBI protein (XP_019461990.1) |
| Pfam | - |
| Rfam | - |
| GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer