Protein coding transcript 1564

• Transcript: Ll_transcript_452828
• CDS coordinates: 169-957 (+)
• Peptide sequence: MGKGNPPKSNTGDDLHAAARSGDLIAVHSILASNPLAVNSRDKHSRTPLHLAAFSGHAEVVSYLCKNKADVGASAMDDMAAIHFAAQKGHLEVFRVLVSAGASFKASTRKGMTSLHYAAQGSHLELVKYLAKKGASLRAKTKAGKTPLDLATNQEVRSFLEEFEKSAKNGEVRNKDEAEQSVPELINKDKDDESDPKTSTLGSEDNLGAETSAAAVDEENSEREKRKGDADDTREESAQPKKARVKLSHLQNSDDNQEEENL*
• ORF Type: complete

Annotations of Ll_transcript_452828

• Blastp: Putative ankyrin repeat protein RF_0381 from spotted fever group with 37.41% of identity
• Blastx: Putative ankyrin repeat protein RF_0381 from spotted fever group with 39.07% of identity
• Eggnog: In eubacteria ppGpp (guanosine 3'-diphosphate 5-' diphosphate) is a mediator of the stringent response that coordinates a variety of cellular activities in response to changes in nutritional abundance (By similarity)(COG0317)
• Kegg: Link to kegg annotations (RF_0381)
• CantataDB: Link to cantataDB annotations (CNT0001169)
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019445221.1)
• Pfam: Ankyrin repeats (3 copies) (PF12796.6)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;