Protein coding transcript 156426

• Transcript: Ll_transcript_235452
• CDS coordinates: 265-1161 (+)
• Peptide sequence: MEGLEGMIERLLEAKKNKGNRIELVESEIRDLCVTAKQIFLSQPNLLELEAPINVCGDIHGQYPDLLRLFEYGGFPPDSNYLFLGDYVDRGKQSIETICLLLAFKIKYPQNFFLLRGNHECASINRIYGFYDECKRRFSVKLWKIFTDCFNCLPVSAVIDEKILCMHGGLSPDMESLNQIKAIERPVDVPDQGLLCDLLWADPDTETRGWGENDRGVSYTFGPDKVADFLNKHDLDLICRAHQVVEDGYQFFADRQLVTIFSAPNYCGEFNNAGALMCVDETLLCSFQILKPLKPKIT*
• ORF Type: complete

Annotations of Ll_transcript_235452

• Blastp: Serine/threonine-protein phosphatase PP1 from Oryza sativa with 78.23% of identity
• Blastx: Serine/threonine-protein phosphatase PP1 from Oryza sativa with 78.67% of identity
• Eggnog: serine threonine-protein phosphatase(ENOG410XPVF)
• Kegg: -
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019427316.1)
• Pfam: Serine-threonine protein phosphatase N-terminal domain (PF16891.4)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;