Transcript | Ll_transcript_413258 |
---|---|
CDS coordinates | 259-810 (+) |
Peptide sequence | MASAVTNNGNEVNGQRRVGLLYNEKMCDHFNLHDPHHPEAPDRIRVIWNKLNKTGICDRCVILDAKEAEDKYIQLVHSKSHVNQIKHISTKQYDSRRHKIALKLNSIYFNEGSSKAAYLAAGSAIEVVEKVASRQLHSAVAIVRPPGHHAEHNEAMGFCLFNNVAISASYLLDERCHFCDSQN* |
ORF Type | complete |
Blastp | Histone deacetylase 5 from Arabidopsis with 70.29% of identity |
---|---|
Blastx | Histone deacetylase 5 from Arabidopsis with 54.55% of identity |
Eggnog | Histone deacetylase(COG0123) |
Kegg | Link to kegg annotations (AT5G61060) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019451711.1) |
Pfam | Histone deacetylase domain (PF00850.18) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer