Protein coding transcript 15645

• Transcript: Ll_transcript_413258
• CDS coordinates: 259-810 (+)
• Peptide sequence: MASAVTNNGNEVNGQRRVGLLYNEKMCDHFNLHDPHHPEAPDRIRVIWNKLNKTGICDRCVILDAKEAEDKYIQLVHSKSHVNQIKHISTKQYDSRRHKIALKLNSIYFNEGSSKAAYLAAGSAIEVVEKVASRQLHSAVAIVRPPGHHAEHNEAMGFCLFNNVAISASYLLDERCHFCDSQN*
• ORF Type: complete

Annotations of Ll_transcript_413258

• Blastp: Histone deacetylase 5 from Arabidopsis with 70.29% of identity
• Blastx: Histone deacetylase 5 from Arabidopsis with 54.55% of identity
• Eggnog: Histone deacetylase(COG0123)
• Kegg: Link to kegg annotations (AT5G61060)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019451711.1)
• Pfam: Histone deacetylase domain (PF00850.18)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;