Protein coding transcript 156457

• Transcript: Ll_transcript_235576
• CDS coordinates: 2-526 (+)
• Peptide sequence: KKMFVFGDSYADTGNIRKSLSNSWKEPYGVTFPGKPAGRFSDGRVLTDYIGSAIFVGTTKNIYFVTFLAMYMKVKSPVPYRLRKLMPQHLKYGINFAVGGTGVFDTLTGGPNMTTQIDLFEQVIKDKVYTASDFNTSVALVSIAGNDYSHYLATNGSTQVIKLTSFILISISIK*
• ORF Type: 5prime_partial

Annotations of Ll_transcript_235576

• Blastp: GDSL esterase/lipase At5g03610 from Arabidopsis with 54.49% of identity
• Blastx: GDSL esterase/lipase At5g03610 from Arabidopsis with 54.49% of identity
• Eggnog: GDSL esterase lipase(ENOG4111T31)
• Kegg: Link to kegg annotations (AT5G03610)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019455740.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;