Transcript | Ll_transcript_235728 |
---|---|
CDS coordinates | 29-685 (+) |
Peptide sequence | MYFVFIILFPSNFLLNMISQAHYMLGLALLNREEYAKGIRELQKALDLGRGADPKGYMVEEIWQELAKAKYIEWQHSSTTRSSELQSLKEACESALKEKQIHDMSQMEGFIEDATTAHVEQLEALREVFNKAALDDIPTEIPDYLCCKITLDIFHDPVITPSGHTYERAVILEHLKKVGKFDPFTRQPLQPSQLVPNLAIKEAVEAFLDKHGWAYKVD* |
ORF Type | complete |
Blastp | E3 ubiquitin-protein ligase CHIP from Arabidopsis with 65.66% of identity |
---|---|
Blastx | E3 ubiquitin-protein ligase CHIP from Arabidopsis with 65.66% of identity |
Eggnog | STIP1 homology and U-box containing protein 1, E3 ubiquitin protein ligase(ENOG410ZC2R) |
Kegg | Link to kegg annotations (AT3G07370) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019449232.1) |
Pfam | U-box domain (PF04564.14) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer