Protein coding transcript 156581

• Transcript: Ll_transcript_235733
• CDS coordinates: 1325-1672 (+)
• Peptide sequence: MSQMEGFIEDATTAHVEQLEALREVFNKAALDDIPTEIPDYLCCKITLDIFHDPVITPSGHTYERAVILEHLKKVGKFDPFTRQPLQPSQLVPNLAIKEAVEAFLDKHGWAYKVD*
• ORF Type: complete

Annotations of Ll_transcript_235733

• Blastp: E3 ubiquitin-protein ligase CHIP from Arabidopsis with 68.42% of identity
• Blastx: E3 ubiquitin-protein ligase CHIP from Arabidopsis with 63.91% of identity
• Eggnog: STIP1 homology and U-box containing protein 1, E3 ubiquitin protein ligase(ENOG410ZC2R)
• Kegg: Link to kegg annotations (AT3G07370)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019449232.1)
• Pfam: Zinc-finger of nitric oxide synthase-interacting protein (PF15906.4)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;