Protein coding transcript 156582

• Transcript: Ll_transcript_235736
• CDS coordinates: 272-760 (+)
• Peptide sequence: MGPNGGSAAAKQAERLRIDGNTYFTKQRFGAAIDAYTEAITLCPNVPVYWTNRALCHLKRNNWERVEEDCRKAIQLDSKLVKAHYMLGLALLNREEYAKGIRELQKALDLGRGADPKGYMVEEIWQELAKAKYLEWERSSSKRSWELQSLKYVFLVIFRPII*
• ORF Type: complete

Annotations of Ll_transcript_235736

• Blastp: E3 ubiquitin-protein ligase CHIP from Arabidopsis with 70.63% of identity
• Blastx: E3 ubiquitin-protein ligase CHIP from Arabidopsis with 70.63% of identity
• Eggnog: STIP1 homology and U-box containing protein 1, E3 ubiquitin protein ligase(ENOG410ZC2R)
• Kegg: Link to kegg annotations (AT3G07370)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019463758.1)
• Pfam: Tetratricopeptide repeat (PF13181.5)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;