Transcript | Ll_transcript_235737 |
---|---|
CDS coordinates | 272-775 (+) |
Peptide sequence | MGPNGGSAAAKQAERLRIDGNTYFTKQRFGAAIDAYTEAITLCPNVPVYWTNRALCHLKRNNWERVEEDCRKAIQLDSKLVKAHYMLGLALLNREEYAKGIRELQKALDLGRGADPKGYMVEEIWQELAKAKYIEWQHSSTTRSSELQSLKYVFPGDCQTYYLRVIH* |
ORF Type | complete |
Blastp | E3 ubiquitin-protein ligase CHIP from Arabidopsis with 69.23% of identity |
---|---|
Blastx | E3 ubiquitin-protein ligase CHIP from Arabidopsis with 69.23% of identity |
Eggnog | STIP1 homology and U-box containing protein 1, E3 ubiquitin protein ligase(ENOG410ZC2R) |
Kegg | Link to kegg annotations (AT3G07370) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019449232.1) |
Pfam | Tetratricopeptide repeat (PF13181.5) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer