Protein coding transcript 156687

• Transcript: Ll_transcript_235306
• CDS coordinates: 1-312 (+)
• Peptide sequence: EHYFPHTLSLFLIFFLFLFSLSSFFSVTDLDLSCLQTRVDSTIIHIFILHQQKKMGIFFIPKATSCILFLFLMSCTCFISTDAYDPLDPNGNITIKWDIISWTP
• ORF Type: internal

Annotations of Ll_transcript_235306

• Blastp: COBRA-like protein 5 from Oryza sativa with 64.1% of identity
• Blastx: COBRA-like protein 5 from Oryza sativa with 64.1% of identity
• Eggnog: cobra-like protein(ENOG410YAAC)
• Kegg: Link to kegg annotations (4333114)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019456436.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;