Protein coding transcript 156692

• Transcript: Ll_transcript_235321
• CDS coordinates: 1182-1868 (+)
• Peptide sequence: MKDVPTYLPDKTILPCNLPREDVRDAFISLNATSLADLPAGSVIGTASLRRKSQILHRYPSLNVQDNFRGNVQSRLRKLSEGVVEATLLALAGLKRLNMTEHVSSTLSIDDMLPAVAQGAIGIACRSNDDKMAEYIASLNHEETRLAVVCERAFLQILDGSCRTPIAGYASRNEDGNCLFRGLVASPDGTRVLETSRVGPYAVEDMIEMGKDAGKELLSRAGPGFFTS*
• ORF Type: complete

Annotations of Ll_transcript_235321

• Blastp: Porphobilinogen deaminase, chloroplastic from Pisum with 89.04% of identity
• Blastx: Porphobilinogen deaminase, chloroplastic from Pisum with 89.83% of identity
• Eggnog: -
• Kegg: -
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019421975.1)
• Pfam: Porphobilinogen deaminase, dipyromethane cofactor binding domain (PF01379.19)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;