Protein coding transcript 156698

• Transcript: Ll_transcript_235313
• CDS coordinates: 273-947 (+)
• Peptide sequence: MEHRRLQQLTKITINDKKFIQTALLSDLRVDGRRPLDYRKLTVKFGRDDGSAEVKLGDTYVISFVTAQLLQPYKDRPNEGSLSVFTEFSPMADPSFEPGRASESAVELGRIVDRGLRESRAIDTESLCVVAGKLVWAIRIDIHVIDNGGNLVDAANVAALAALLTFRRPECSLTGEDGQQVVVHPPEERDPLPLIIHHLPIAVTFGFFSNENLVVWIFYIFISH*
• ORF Type: complete

Annotations of Ll_transcript_235313

• Blastp: Exosome complex component RRP45B from Arabidopsis with 73.46% of identity
• Blastx: Exosome complex component RRP45B from Arabidopsis with 73.46% of identity
• Eggnog: Exosome complex(COG2123)
• Kegg: Link to kegg annotations (AT3G60500)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019421238.1)
• Pfam: 3' exoribonuclease family, domain 1 (PF01138.20)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;