Transcript | Ll_transcript_235313 |
---|---|
CDS coordinates | 273-947 (+) |
Peptide sequence | MEHRRLQQLTKITINDKKFIQTALLSDLRVDGRRPLDYRKLTVKFGRDDGSAEVKLGDTYVISFVTAQLLQPYKDRPNEGSLSVFTEFSPMADPSFEPGRASESAVELGRIVDRGLRESRAIDTESLCVVAGKLVWAIRIDIHVIDNGGNLVDAANVAALAALLTFRRPECSLTGEDGQQVVVHPPEERDPLPLIIHHLPIAVTFGFFSNENLVVWIFYIFISH* |
ORF Type | complete |
Blastp | Exosome complex component RRP45B from Arabidopsis with 73.46% of identity |
---|---|
Blastx | Exosome complex component RRP45B from Arabidopsis with 73.46% of identity |
Eggnog | Exosome complex(COG2123) |
Kegg | Link to kegg annotations (AT3G60500) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019421238.1) |
Pfam | 3' exoribonuclease family, domain 1 (PF01138.20) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer