Protein coding transcript 1567

• Transcript: Ll_transcript_452803
• CDS coordinates: 111-857 (+)
• Peptide sequence: MGRGRVQLKRIENKTSQQVTFSKRRTGLLKKAHEISVLCDTQVALIMFSTKGKLFEYSSEPSVENVLERYERHAHTIHAGANNESQENWSFDYFKLTAKAEVLERNIRNFAGYDLDPLNLKELQNLEHQLDTALKRIRTRKNQVLNQSISEMQKRARTLQEQNSMLAKMKEKEKTLTENSQAETLGQSSSPFNLSSQKQLLRQRQVPSLTLSGTLQARASPEETVGAQAAAAGAGSSNTLIPPWMLHG*
• ORF Type: complete

Annotations of Ll_transcript_452803

• Blastp: Agamous-like MADS-box protein AGL8 from Arabidopsis with 53.2% of identity
• Blastx: Agamous-like MADS-box protein AGL8 from Arabidopsis with 50% of identity
• Eggnog: Transcription factor(COG5068)
• Kegg: Link to kegg annotations (AT5G60910)
• CantataDB: Link to cantataDB annotations (CNT0000849)
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019456546.1)
• Pfam: SRF-type transcription factor (DNA-binding and dimerisation domain) (PF00319.17)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;