Protein coding transcript 156700

• Transcript: Ll_transcript_235318
• CDS coordinates: 1550-2233 (+)
• Peptide sequence: MTGRMTTTLNANGDVCSIQKAGGEGVSQRVIMHCLKLAHVKAGDITTKIRDAVEIHNTERALRKIKRHSSSVPVDVCGTTARLEGKQNDSDGDKDGGHLDQLKLKDEANAMECDATSSGSVQSNKKDGLSKNFIGGPSSWDPYSECVNSDILKASQASRGASTPLSKQKDSQGETKREEQTHEVKTNSSSAMDIAPTAEQSNEGKTLNDAVKPKNKRKKKASSNGRN*
• ORF Type: complete

Annotations of Ll_transcript_235318

• Blastp: Exosome complex component RRP45B from Arabidopsis with 45.45% of identity
• Blastx: Exosome complex component RRP45B from Arabidopsis with 72.68% of identity
• Eggnog: Exosome complex(COG2123)
• Kegg: Link to kegg annotations (AT3G60500)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019423612.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;