| Transcript | Ll_transcript_235320 |
|---|---|
| CDS coordinates | 373-726 (+) |
| Peptide sequence | MECDAKTPGQVQSNKRDGVSNNFIGGPSSWDPYSERVDSDSLKASLASRGQLTPHSKQNDPRSETKREEQPKEVKTNSSSAMDIAPNVGQSNEGKTLKDAVKPKHKRKKKASSNGRN* |
| ORF Type | complete |
| Blastp | Exosome complex component RRP45B from Arabidopsis with 63.41% of identity |
|---|---|
| Blastx | Exosome complex component RRP45B from Arabidopsis with 40.71% of identity |
| Eggnog | Exosome complex(COG2123) |
| Kegg | Link to kegg annotations (AT3G60500) |
| CantataDB | - |
| Mirbase | - |
| Ncbi protein | Link to NCBI protein (XP_019421238.1) |
| Pfam | - |
| Rfam | - |
| GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer