Protein coding transcript 156799

• Transcript: Ll_transcript_234105
• CDS coordinates: 459-896 (+)
• Peptide sequence: MEISLLKMLVSGISSFLHLSFSGKKNLEPVTKYYQKAEEILKLVKPIIDVIVNSELASDEVLCKLFEELGHAVDELREHIENWHLLSRKVYFVMKAEPLISRIRTSGLNIFQQLKAFHDCLPDELSSEHVEHCVQKLKHLGHDKTS
• ORF Type: 3prime_partial

Annotations of Ll_transcript_234105

• Blastp: U-box domain-containing protein 4 from Arabidopsis with 42.55% of identity
• Blastx: U-box domain-containing protein 4 from Arabidopsis with 42.55% of identity
• Eggnog: U-box domain-containing protein 4-like(ENOG410XU9Y)
• Kegg: Link to kegg annotations (AT2G23140)
• CantataDB: Link to cantataDB annotations (CNT0002429)
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019434110.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;