Transcript | Ll_transcript_235499 |
---|---|
CDS coordinates | 137-472 (+) |
Peptide sequence | MASCNIASVASGFLLSPNVATNSPSSRNNTMVMFPTKNNVSSSSSFSRLVVRAEDDAASASAPSTVTTPVEGEVAKKPKPPPIGPKRGAKVKILRRESYWYKETGSVVAVEQ |
ORF Type | 3prime_partial |
Blastp | Photosystem I reaction center subunit IV A, chloroplastic from Nicotiana with 55.75% of identity |
---|---|
Blastx | Photosystem I reaction center subunit IV A, chloroplastic from Nicotiana with 55.75% of identity |
Eggnog | - |
Kegg | - |
CantataDB | Link to cantataDB annotations (CNT0000800) |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019429588.1) |
Pfam | Photosystem I reaction centre subunit IV / PsaE (PF02427.16) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer