Transcript | Ll_transcript_234411 |
---|---|
CDS coordinates | 85-495 (+) |
Peptide sequence | MARTKQTARKSTGGKAPRKQLATKAARKSAPSTGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSAAIGALQEASEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA* |
ORF Type | complete |
Blastp | Histone H3.3 from Silurana with 100% of identity |
---|---|
Blastx | Histone H3.3 from Silurana with 100% of identity |
Eggnog | Core component of nucleosome. Nucleosomes wrap and compact DNA into chromatin, limiting DNA accessibility to the cellular machineries which require DNA as a template. Histones thereby play a central role in transcription regulation, DNA repair, DNA replication and chromosomal stability. DNA accessibility is regulated via a complex set of post-translational modifications of histones, also called histone code, and nucleosome remodeling(COG2036) |
Kegg | Link to kegg annotations (100038101) |
CantataDB | Link to cantataDB annotations (CNT0000247) |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019435472.1) |
Pfam | Core histone H2A/H2B/H3/H4 (PF00125.23) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer