Protein coding transcript 156949

• Transcript: Ll_transcript_234557
• CDS coordinates: 1-417 (+)
• Peptide sequence: QVEKLKLENATLYKQFMHASQQFRDADTNNRVLKSDVEALRAKVKLAEDMVTRSSFTLNNQFLQTQMSTLPQLSTTNLPGVAHVSPTITVHGNDASYGGVTVGGQNSTHGLGNLDITYNNNVNNGVFSDAASSVTMWQ*
• ORF Type: 5prime_partial

Annotations of Ll_transcript_234557

• Blastp: Basic leucine zipper 9 from Arabidopsis with 56.52% of identity
• Blastx: Basic leucine zipper 9 from Arabidopsis with 56.52% of identity
• Eggnog: Basic region leucine zipper(ENOG410YMIG)
• Kegg: Link to kegg annotations (AT5G24800)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019435998.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;