Protein coding transcript 157007

• Transcript: Ll_transcript_234407
• CDS coordinates: 2-790 (+)
• Peptide sequence: FGSEDAMIRLDMSEFMERHTVSKLIGSPPGYVGYTEGGQLTEAVRRRPYTVVLFDEIEKAHPDVFNMMLQILEDGRLTDSKGRTVDFKNTLLIMTSNVGSSVIEKGGRKIGFDLDYDEKDSSYNRIKSLVTEELKQYFRPEFLNRLDEMIVFRQLTKLEVKEIADIMLKEVFERLKTKEIELSVTERFRERVVDEGYNPSYGARPLRRAIMRLLEDSMAEKMLAREIKEGDSGIVDADSDGNVIVLNGSSGAPDSLPEALSV*
• ORF Type: 5prime_partial

Annotations of Ll_transcript_234407

• Blastp: Chaperone protein ClpC, chloroplastic from Pisum with 95.8% of identity
• Blastx: Chaperone protein ClpC, chloroplastic from Pisum with 95.8% of identity
• Eggnog: -
• Kegg: -
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019463459.1)
• Pfam: AAA domain (Cdc48 subfamily) (PF07724.13)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;