Protein coding transcript 157028

• Transcript: Ll_transcript_235791
• CDS coordinates: 22-312 (+)
• Peptide sequence: MATTSIIISATSSSNSAQGKKCKYVGQSVRAVPLRIVSVGKKRSKGLQLIVDDYVEKLKYYCAVEDVQIRSNPRNARDQRAQVDDEDSAVMNLIRL*
• ORF Type: complete

Annotations of Ll_transcript_235791

• Blastp: Putative RNA methyltransferase At5g10620 from Arabidopsis with 53.12% of identity
• Blastx: Putative RNA methyltransferase At5g10620 from Arabidopsis with 79.31% of identity
• Eggnog: rRNA processing(COG1576)
• Kegg: Link to kegg annotations (AT5G10620)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019447505.1)
• Pfam: Predicted SPOUT methyltransferase (PF02590.16)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;