Transcript | Ll_transcript_235792 |
---|---|
CDS coordinates | 22-582 (+) |
Peptide sequence | MATTSIIISATSSSNSAQGKKCKYVGQSVRAVPLRIVSVGKKRSKGLQLIVDDYVEKLKYYCAVEDVQIRSNPRNARDQRAQVDDEDSAVMNLIRSDDWVVMLDEHGQDIGSEQMAELVGDAGNTGASRLSFCIGGPYGHGRKLRERANVSIKLSSLVLNHQIALLVLMEQLYRSWTILRGQKYHH* |
ORF Type | complete |
Blastp | Putative RNA methyltransferase At5g10620 from Arabidopsis with 67.42% of identity |
---|---|
Blastx | Putative RNA methyltransferase At5g10620 from Arabidopsis with 70.41% of identity |
Eggnog | rRNA processing(COG1576) |
Kegg | Link to kegg annotations (AT5G10620) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019447505.1) |
Pfam | Predicted SPOUT methyltransferase (PF02590.16) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer