Protein coding transcript 157095

• Transcript: Ll_transcript_235069
• CDS coordinates: 256-591 (+)
• Peptide sequence: MGNVDAALKTSLLWLAALILVVGLCTHSMKKMMVTYVMGVVGISGVLLPDWDYFNRDFSRWGYPITAEERASHLAQGSGFLRFAYSPLRVIAYCVIYGYAMYKWWKYVTSS*
• ORF Type: complete

Annotations of Ll_transcript_235069

• Blastp: Signal peptidase complex-like protein DTM1 from Oryza sativa with 41.67% of identity
• Blastx: Signal peptidase complex-like protein DTM1 from Oryza sativa with 41.67% of identity
• Eggnog: Microsomal signal peptidase 12 kDa subunit (SPC12)(ENOG410YTII)
• Kegg: Link to kegg annotations (4343951)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019438530.1)
• Pfam: Microsomal signal peptidase 12 kDa subunit (SPC12) (PF06645.12)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;