Protein coding transcript 157131

• Transcript: Ll_transcript_233786
• CDS coordinates: 54-521 (-)
• Peptide sequence: MSSFTLVTSLPKFGHGGATIARASPWNPRVFAAATPRPIQVPKSPNQQEGSVTTDGTNQGASETVNNNLNEPLQDKAYSSTTEHVSNRTRDMAGEASIKAQNITEKAKQTMQEAWDSTKKTANKAADTVMGKTQESADCVKENAEKMRRNINTKN*
• ORF Type: complete

Annotations of Ll_transcript_233786

• Blastp: Uncharacterized protein At4g13230 from Arabidopsis with 30.97% of identity
• Blastx: Uncharacterized protein At4g13230 from Arabidopsis with 30.97% of identity
• Eggnog: NA(ENOG410Z6WR)
• Kegg: Link to kegg annotations (AT4G13230)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019460330.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;