Transcript | Ll_transcript_233794 |
---|---|
CDS coordinates | 569-868 (+) |
Peptide sequence | MQLSQIPYPGGAKFMVPEAPAPPNNILFIQNLPNETTPMMLQMLFLQYPGFKEVRMVETKPGIAFVEYGDEMQSTVAMQALQSFKITPQNPMLITYAKK* |
ORF Type | complete |
Blastp | U1 small nuclear ribonucleoprotein A from Arabidopsis with 80.41% of identity |
---|---|
Blastx | U1 small nuclear ribonucleoprotein A from Arabidopsis with 80.41% of identity |
Eggnog | Small nuclear ribonucleoprotein(ENOG410XPZI) |
Kegg | Link to kegg annotations (AT2G47580) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019465429.1) |
Pfam | RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain) (PF13893.5) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer