Protein coding transcript 157139

• Transcript: Ll_transcript_233802
• CDS coordinates: 128-868 (+)
• Peptide sequence: MSDIVNAGGDEAPKNVTIYINNLNEKIKIEKLKKSLVAVFSQFGKILEVLAFKTLKHKGQAWVVFENVSSASDAIRQMQGFPFYDKPMRIQYAKTKSDVIAKADGTFVPRERRKRHDDKGKKRKDQHDANLAGVGINPAYAGAYGATPALSQIPYPGGAKFMVPEAPAPPNNILFIQNLPNETTPMMLQMLFLQYPGFKEVRMVETKPGIAFVEYGDEMQSTVAMQALQSFKITPQNPMLITYAKK*
• ORF Type: complete

Annotations of Ll_transcript_233802

• Blastp: U1 small nuclear ribonucleoprotein A from Arabidopsis with 73.09% of identity
• Blastx: U1 small nuclear ribonucleoprotein A from Arabidopsis with 71.89% of identity
• Eggnog: Small nuclear ribonucleoprotein(ENOG410XPZI)
• Kegg: Link to kegg annotations (AT2G47580)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019451449.1)
• Pfam: RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain) (PF00076.21)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;