Protein coding transcript 157142

• Transcript: Ll_transcript_233806
• CDS coordinates: 1491-1973 (+)
• Peptide sequence: MQRIQYAKTKSDVIAKADGTFVPRERRKRHDDKGKKRKDQHDANLAGVGINPAYAGAYGATPALSQIPYPGGAKFMVPEAPAPPNNILFIQNLPNETTPMMLQMLFLQYPGFKEVRMVETKPGIAFVEYGDEMQSTVAMQALQSFKITPQNPMLITYAKK*
• ORF Type: complete

Annotations of Ll_transcript_233806

• Blastp: U1 small nuclear ribonucleoprotein A from Arabidopsis with 74.53% of identity
• Blastx: U1 small nuclear ribonucleoprotein A from Arabidopsis with 72.67% of identity
• Eggnog: Small nuclear ribonucleoprotein(ENOG410XPZI)
• Kegg: Link to kegg annotations (AT2G47580)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019465429.1)
• Pfam: RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain) (PF13893.5)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;