Transcript | Ll_transcript_234134 |
---|---|
CDS coordinates | 126-548 (+) |
Peptide sequence | MPKVKADSKPVDNKLKRKGAGSGNKKSKKAAKDPNKPKRPPSAFFVFMSEFREQYKKDFPENKSVANVSKAGGSKWKSMSDAEKAPYVARAEKKKEEYGRTIEAYNRKLEGKNPSEEDESDKSKSEVHDDDEDEEEDDDE* |
ORF Type | complete |
Blastp | HMG1/2-like protein from Ipomoea with 60.98% of identity |
---|---|
Blastx | HMG1/2-like protein from Vicia with 72.22% of identity |
Eggnog | - |
Kegg | Link to kegg annotations (109177607) |
CantataDB | Link to cantataDB annotations (CNT0002562) |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019446905.1) |
Pfam | HMG-box domain (PF09011.9) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer