Protein coding transcript 157148

• Transcript: Ll_transcript_234134
• CDS coordinates: 126-548 (+)
• Peptide sequence: MPKVKADSKPVDNKLKRKGAGSGNKKSKKAAKDPNKPKRPPSAFFVFMSEFREQYKKDFPENKSVANVSKAGGSKWKSMSDAEKAPYVARAEKKKEEYGRTIEAYNRKLEGKNPSEEDESDKSKSEVHDDDEDEEEDDDE*
• ORF Type: complete

Annotations of Ll_transcript_234134

• Blastp: HMG1/2-like protein from Ipomoea with 60.98% of identity
• Blastx: HMG1/2-like protein from Vicia with 72.22% of identity
• Eggnog: -
• Kegg: Link to kegg annotations (109177607)
• CantataDB: Link to cantataDB annotations (CNT0002562)
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019446905.1)
• Pfam: HMG-box domain (PF09011.9)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;