Protein coding transcript 157206

• Transcript: Ll_transcript_233688
• CDS coordinates: 62-364 (+)
• Peptide sequence: MEEALDLMRKWVMSIVAVVVVLGLWSRSVGAAPQVPCYFIFGDSLVDNGNNNQLQSLARADYLPYGIDFPNGPSGRFCNGKTTVDAIGDLTYLSVTIFIN*
• ORF Type: complete

Annotations of Ll_transcript_233688

• Blastp: GDSL esterase/lipase At1g29660 from Arabidopsis with 65.06% of identity
• Blastx: GDSL esterase/lipase At4g18970 from Arabidopsis with 74.19% of identity
• Eggnog: GDSL-motif lipase hydrolase family protein(ENOG410YD3P)
• Kegg: Link to kegg annotations (AT1G29660)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019462519.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;