Protein coding transcript 157209

• Transcript: Ll_transcript_233691
• CDS coordinates: 2061-2513 (+)
• Peptide sequence: MVLFGVGQIGCSPNELAQNSPDGSTCVERINTANQIFNNKLKSLVDQLNNQLPDARFIYINSYAIFQDIISNPTAYGFSNINSGCCGVGRNNGQITCLPMQTPCSNRREYLFWDAFHPTEAGNVVVAQRAYNSESADHAYPIDIRRLAQI*
• ORF Type: complete

Annotations of Ll_transcript_233691

• Blastp: GDSL esterase/lipase At1g29670 from Arabidopsis with 68% of identity
• Blastx: GDSL esterase/lipase At1g29670 from Arabidopsis with 68.32% of identity
• Eggnog: GDSL-motif lipase hydrolase family protein(ENOG410YD3P)
• Kegg: Link to kegg annotations (AT1G29670)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019444688.1)
• Pfam: GDSL-like Lipase/Acylhydrolase (PF00657.21)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;