Protein coding transcript 157258

• Transcript: Ll_transcript_233821
• CDS coordinates: 204-1685 (+)
• Peptide sequence: MIKWVKQLNATFGVSFLWLICLIYFSQGFRSFVWTAVSYQLKDNLKLSPSASQFVSSVAFFPWSIKPLYGILSDCIPIKGRKRIPYLVIATVLSLVPWFILGLNSTLRSSTWHLMVLLTVQNVGSAMADVVADAMIAEAVRYDRASFSGDLQSISWSAMAVGGICGGLLGGYALSNLQIDTIFLLFSVLPCIQLLSCYFVEENSVGSKVLEEDSVVRDLHTSENTLDDDIPLTKISHSSTTKRKKGKKNVKSRAVNTSKTKILQKGDSMALKLFHTLKEAIYDLCRAFRQPMILRPMAWFFLAHVTVPDLSTVIFYYETEVLKLEASFLGTVQVASWLGLMLGIFIYNRHIKHMTLRTILMCAHIGLTFFSLLKIVLVSRKNIAYGVPDKIMVILISALTEGINQFKFIPFLTLSGTLCPPGIEGTLFALFMSINNFGSTVGSFMGAGLASILNIDSGSFDNLLLGIIIHGLCNFIPIAFLFLIPKEATGLSS*
• ORF Type: complete

Annotations of Ll_transcript_233821

• Blastp: Probable folate-biopterin transporter 4 from Arabidopsis with 65.52% of identity
• Blastx: Probable folate-biopterin transporter 4 from Arabidopsis with 65.52% of identity
• Eggnog: BT1 family(ENOG410XRKZ)
• Kegg: Link to kegg annotations (AT5G54860)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019424603.1)
• Pfam: Major Facilitator Superfamily (PF07690.15)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;