Transcript | Ll_transcript_233929 |
---|---|
CDS coordinates | 108-626 (+) |
Peptide sequence | MIRISNTLVGALNILSLLIGLVAVGTSAYIHVHGGASTNCQRVLQYPLLFGGVFVVLVSTLAIVGSMCRVNVALYMYLFVTFLLIVWLVLFTIFALFVTNRKVGQNVSGNGEYKVTDFSHWLQRYVVNNKNWDEVKSCLMDAHVCQNLALNGGRNNDSLIFKHLSTTQVVLL* |
ORF Type | complete |
Blastp | Tetraspanin-8 from Arabidopsis with 42.67% of identity |
---|---|
Blastx | Tetraspanin-8 from Arabidopsis with 42.67% of identity |
Eggnog | senescence-associated protein(ENOG410XRN9) |
Kegg | Link to kegg annotations (AT2G23810) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019463661.1) |
Pfam | Tetraspanin family (PF00335.19) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer