Protein coding transcript 157400

• Transcript: Ll_transcript_235047
• CDS coordinates: 2969-3424 (+)
• Peptide sequence: MAKRQKMQHPQQHTRLPPIQQSGQHAQMRSGPNQQVHGSQQVHAGGPGHHYGKPRGPSGGPGKYPPGGNPGGGYNHPNRGGQGGAGGYGSGPYPPPGRGAPYGSSGMPGGSGGFGVGAPNYTQQGPYGGSAAGRGSNMMGGNRNQQYGWQQ*
• ORF Type: complete

Annotations of Ll_transcript_235047

• Blastp: Cyclin-dependent kinase C-1 from Arabidopsis with 52.56% of identity
• Blastx: Cyclin-dependent kinase C-2 from Oryza sativa with 90.62% of identity
• Eggnog: Cyclin-Dependent Kinase(ENOG410XPIR)
• Kegg: Link to kegg annotations (AT5G10270)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019460261.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;