Protein coding transcript 157428

• Transcript: Ll_transcript_235089
• CDS coordinates: 114-1025 (+)
• Peptide sequence: MAETKAPKDPYGFLKDFMAGGISAAVSKTAVAPIERVKLILQVQAASTQIAADKQYKGIMDCLVRIPKEQGFASFWRGNFANVIRYFPTQALNFAFKDVYKQVFMDGVDKKTQFWRYFAGNLASGGAAGATSLCFVYPLDYARTRLGADVGKGPAERQFKGLGDCLAKTVKSDGPIGLYRGFIVSVQGIIIYRAAYFGFFDTAKGMLPDPKNTPFLVSWGIAQFVTTFAGIMSYPFDTVRRRMMMQSGRAADQRMYKSTLDCWSKLYKNEGTSAFFKGAFSNVLRGTGGALVLVFYDELKNLM*
• ORF Type: complete

Annotations of Ll_transcript_235089

• Blastp: ADP,ATP carrier protein 1 from Anopheles with 83.39% of identity
• Blastx: ADP,ATP carrier protein 1 from Anopheles with 83.39% of identity
• Eggnog: transmembrane transport(ENOG410XNW0)
• Kegg: Link to kegg annotations (AgaP_AGAP006782)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_003543333.1)
• Pfam: Mitochondrial carrier protein (PF00153.26)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;