Protein coding transcript 157473

• Transcript: Ll_transcript_106701
• CDS coordinates: 64-984 (+)
• Peptide sequence: MSIPHSSIFTILSPIHSSFNSSLSSSSLLSSFHSNHKHSPPTTWLPLRRSLPCRAMVQQAVQGPQAAYAKEMERLSAKESLLLAFKDAGGFEALVSGKTNDIQKIDVIERITGLERLNPTPRPTTSPFLEGRWNFEWFGSGSPGFFAAKFIFETFPSSLANLSKLDVFFKDGNAKVTASMGLLNSIESKIILQTKLSVEGPLRMKEEYVEGVLVSPTVIEDRVPEQLKGALGQAANALQQLPAPIRDVVASGLKVPLSGSFQRLFMISYLDEEILIIRDTAGMPEVLTRLDASPSSLAESIPEYVS*
• ORF Type: complete

Annotations of Ll_transcript_106701

• Blastp: Probable plastid-lipid-associated protein 13, chloroplastic from Arabidopsis with 72.59% of identity
• Blastx: Probable plastid-lipid-associated protein 13, chloroplastic from Arabidopsis with 71.1% of identity
• Eggnog: plastid-lipid-associated protein(ENOG410Y4Z3)
• Kegg: Link to kegg annotations (AT2G42130)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019453345.1)
• Pfam: PAP_fibrillin (PF04755.11)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;