Transcript | Ll_transcript_106702 |
---|---|
CDS coordinates | 2136-2447 (+) |
Peptide sequence | MKEEYVEGVLVSPTVIEDRVPEQLKGALGQAANALQQLPAPIRDVVASGLKVPLSGSFQRLFMISYLDEEILIIRDTAGMPEVLTRLDASPSSLAESIPEYVS* |
ORF Type | complete |
Blastp | Probable plastid-lipid-associated protein 13, chloroplastic from Arabidopsis with 69.9% of identity |
---|---|
Blastx | Probable plastid-lipid-associated protein 13, chloroplastic from Arabidopsis with 70.4% of identity |
Eggnog | plastid-lipid-associated protein(ENOG410Y4Z3) |
Kegg | Link to kegg annotations (AT2G42130) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019453345.1) |
Pfam | - |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer