Transcript | Ll_transcript_106195 |
---|---|
CDS coordinates | 182-1162 (+) |
Peptide sequence | MGSFWIWWIIALIHILPFFDSKPLIQTIQGRTPQSPVECNQSGCTLQNSYGAWGDRKDCYALNITYPTTEEQLRLAVSHAVQNNLKVKVVTKFSHTIPKLACPEGKTNTLLISTEKYDSGIQIDAANLAVTADSGVGLRALIDAVESAGFSLVAAPYWEGVSVGGLISTGAHGSSWWGKGGAVHDHVLGLRIIVPASEYEGYAKILWLEAPDPLFNAAKVSLGVLGAISKVKLSLEHRFKRSITYNFTDDAYIEDVYINHAKQYEFADITWYPSKHTAVYRYDSRVSLDASGDGVYDFIGFQANSILISESVRAAGNDLFNCTSKF* |
ORF Type | complete |
Blastp | L-gulonolactone oxidase 3 from Arabidopsis with 63.25% of identity |
---|---|
Blastx | L-gulonolactone oxidase 3 from Arabidopsis with 67.67% of identity |
Eggnog | FAD linked oxidase domain protein(COG0277) |
Kegg | Link to kegg annotations (AT5G11540) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019429823.1) |
Pfam | FAD binding domain (PF01565.22) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer