Transcript | Ll_transcript_104703 |
---|---|
CDS coordinates | 358-1251 (+) |
Peptide sequence | MSFSASAEFPCFEPSPQAQTILHCLLRHLLQRDKIEEALRLAELSAEKPHFSHCLEWLLFTVFEADISRPNMNKNQISIPNHAKSTLLEKTCDLIRNFPEYFDVVVSVARKTDGRHWADLFSAAGRSTELFEECFQRRWYRTAACYILVIAKLEGPAVSQYCALRLLQATLDESLYELAGELVRFLLRSGREYDQSLTDSDKLSPRFLGYFLFRSSDRKQPLDRSTSLKEQSAHITSVKNILENHASFLMAGKELSKLVAFVKGTQFDLVEYLQRERYGSARLENFSSGLELISQKV* |
ORF Type | complete |
Blastp | RAB6A-GEF complex partner protein 1 from Mus with 29.43% of identity |
---|---|
Blastx | RAB6A-GEF complex partner protein 1 from Mus with 28.61% of identity |
Eggnog | protein RIC1 homolog(ENOG410XT5J) |
Kegg | - |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_020996625.1) |
Pfam | RIC1 (PF07064.12) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer