Protein coding transcript 157596

• Transcript: Ll_transcript_105917
• CDS coordinates: 87-635 (+)
• Peptide sequence: MATESDSHSNTVAVQATNDDASASKLSCVKKSYMKDDYIHLFVRKPLKRSPIINRGYFARWAAFRKLLYQFLDVGSTKKQILSLGAGFDTTYFQLQDEGKAPYLYVEVDFKEVTSKKAALIESYSQLRSKVGETASISREKGEVLSDHYKLLPVDLRDTQKLSDIAALAGMDTRMCSDLPGP*
• ORF Type: complete

Annotations of Ll_transcript_105917

• Blastp: tRNA wybutosine-synthesizing protein 4 from Mus with 38.6% of identity
• Blastx: tRNA wybutosine-synthesizing protein 4 from Mus with 41.32% of identity
• Eggnog: leucine carboxyl methyltransferase(ENOG410YB9K)
• Kegg: Link to kegg annotations (329504)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_003551714.1)
• Pfam: Leucine carboxyl methyltransferase (PF04072.13)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;